Transcript | Ll_transcript_522517 |
---|---|
CDS coordinates | 204-896 (+) |
Peptide sequence | MQTLIACSSHSHGKVQSHTNLVPVIIFPKHNSNLSLTRSSSHLILQCKFQPQPFFNSSALVPTSKSPIIFTSNVSPLLCGISSNRYSASGGRSIGEWVELVGEVLSTAFPLWVTVGCVLGLMRPSSFKWVTPQLNIVGLTIVMVCMGMTLSLDDLRGALAMPKEVLSGFVLQYSVMPLSGYFVSKLLNLPSHYAAGLILVGCCPGGTASNIVTYLARYVDSQNCYFKQCF* |
ORF Type | complete |
Blastp | Probable sodium/metabolite cotransporter BASS1, chloroplastic from Arabidopsis with 75.54% of identity |
---|---|
Blastx | Probable sodium/metabolite cotransporter BASS1, chloroplastic from Arabidopsis with 71.84% of identity |
Eggnog | bile acid(COG0385) |
Kegg | Link to kegg annotations (AT1G78560) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019443834.1) |
Pfam | Sodium Bile acid symporter family (PF01758.15) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer