Protein coding transcript 258673

• Transcript: Ll_transcript_37208
• CDS coordinates: 461-1141 (+)
• Peptide sequence: MADLAGLVEAAGSRFSSLELIGQGSFGDVYKGFDKELNKEVAIKVIDLEESEDEIDDIQKEISVLSQCRSQYITEYYGSYLNQTKLWIIMEYMAGGSVADLLQSGPPLDEMSIACILRDLLHAIDYLHTEGKIHRDIKAANILLNENGDVKVADFGVSAQLSRTISRRKTFVGTPFWMAPEVIQNSEGYNEKADIWSLGITVIEMAKGEPPLADLHPMRVLFIIPRE
• ORF Type: 3prime_partial

Annotations of Ll_transcript_37208

• Blastp: Serine/threonine-protein kinase svkA from Dictyostelium with 66.51% of identity
• Blastx: Serine/threonine-protein kinase 26 from Homo with 67.45% of identity
• Eggnog: mitogen-activated protein kinase kinase kinase kinase(ENOG410XP9G)
• Kegg: Link to kegg annotations (DDB_G0286359)
• CantataDB: Link to cantataDB annotations (CNT0001773)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019425734.1)
• Pfam: Protein kinase domain (PF00069.24)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;