Transcript | Ll_transcript_37192 |
---|---|
CDS coordinates | 176-937 (+) |
Peptide sequence | MSDLAGLAEAAGSRFTSLELIGQGSFGDVYKGFDKELNKEVAIKVIDLEESEDEIDDIQKEISVLSQCRSQYITEYYGSYLNQTKLWIIMEYMAGGSVADLLQSGPPLDEMSIACILRDLLHAIDYLHAEGKIHRDIKAANILLTENGDVKVADFGVSAQLTRTISRRKTFVGTPFWMAPEVIQNTDGYNEKADIWSLGITVIEMAKGEPPLADLHPMRVLFIIPRENPPQLDEHFSRPLKEFASLCLKKVPAE |
ORF Type | 3prime_partial |
Blastp | Serine/threonine-protein kinase svkA from Dictyostelium with 64.17% of identity |
---|---|
Blastx | Serine/threonine-protein kinase 24 from Rattus with 67.36% of identity |
Eggnog | mitogen-activated protein kinase kinase kinase kinase(ENOG410XP9G) |
Kegg | Link to kegg annotations (DDB_G0286359) |
CantataDB | Link to cantataDB annotations (CNT0001773) |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019443927.1) |
Pfam | Protein kinase domain (PF00069.24) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer