| Transcript | Ll_transcript_147355 |
|---|---|
| CDS coordinates | 78-500 (-) |
| Peptide sequence | VAFAGALPAFQIINKVAIELGFDVSIGYGMTETKGPVLLWPWKLNSDDSEPLKAPEDCKIENNTKLPEETLIEENLEGLQYDEASAGTGIAVGNMVSDISRHSKDQSLDHSDEYLHRSSCNDGTSCCSISNTSPFEFLRH* |
| ORF Type | 5prime_partial |
| Blastp | Probable acyl-activating enzyme 9 from Arabidopsis with 33.33% of identity |
|---|---|
| Blastx | - |
| Eggnog | Amp-dependent synthetase and ligase(COG0318) |
| Kegg | Link to kegg annotations (AT1G21540) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019445711.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer