Protein coding transcript 258764

• Transcript: Ll_transcript_145794
• CDS coordinates: 2-598 (+)
• Peptide sequence: QDLFNGKALCKSINPDEAVAYGAAVQAAILSGEGNEKVQALLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVFEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEDIEKMVQEAEKYKSEDEKQKKKVEDKNALENYAYNM
• ORF Type: internal

Annotations of Ll_transcript_145794

• Blastp: Heat shock cognate 70 kDa protein 2 from Lycopersicon with 95.48% of identity
• Blastx: Heat shock cognate 70 kDa protein 2 from Lycopersicon with 95.48% of identity
• Eggnog: Heat shock protein(COG0443)
• Kegg: Link to kegg annotations (101247772)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019444400.1)
• Pfam: Hsp70 protein (PF00012.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;