| Transcript | Ll_transcript_145789 |
|---|---|
| CDS coordinates | 3-350 (+) |
| Peptide sequence | YKSEDEEHKKKVEAKTALENYAYNMRNTIKDDKIGEKLAADDKKKIEDAIEQAIQWLDSNQLGEADEFEDKMKELESICNPIIAKMYQGGAGPDAGGAAEYADAPSGGGGAGPKIE |
| ORF Type | internal |
| Blastp | Heat shock cognate 70 kDa protein from Petunia with 76.23% of identity |
|---|---|
| Blastx | Probable mediator of RNA polymerase II transcription subunit 37c from Arabidopsis with 88.64% of identity |
| Eggnog | - |
| Kegg | - |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019425446.1) |
| Pfam | Hsp70 protein (PF00012.19) |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer