Protein coding transcript 25878

• Transcript: Ll_transcript_520590
• CDS coordinates: 123-1157 (+)
• Peptide sequence: MQLNTTFSKNQSMASPLPKPLLPWKTRLAIFCLSTLSSASRRSDGTINRRLFDLFDFKLPPNPEPVNGVSTYDVVVDPTRNLWFRVFAPSSSDTDGKLPVVVFFHGGGFSFLSPESKAYDAVCRLFSSSLPAVVVSVNYRLTPEHRYPSQYDDGFDVLKFLDENGTVLSKIADVSKCFLAGDSAGGNIAHHVAVRVCQQKLQVVNVIGLISIQPFFGGEERTESEMRMKEAPIVTAEIADWHWKVFLPEGSNRDHEVVNVSGPNGVHITGLDYPSTLVFTGGFDPLQDWQKRYYEWLRKCGKEACLIEYPTMIHGFYIFPEFPEATQLISQVKDFIIRQVSNVK*
• ORF Type: complete

Annotations of Ll_transcript_520590

• Blastp: Probable carboxylesterase 18 from Arabidopsis with 60.18% of identity
• Blastx: Probable carboxylesterase 18 from Arabidopsis with 60.18% of identity
• Eggnog: alpha beta hydrolase fold-3 domain protein(COG0657)
• Kegg: Link to kegg annotations (AT5G23530)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019449462.1)
• Pfam: Steryl acetyl hydrolase (PF10340.8)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;