Protein coding transcript 2589

• Transcript: Ll_transcript_301496
• CDS coordinates: 1-420 (+)
• Peptide sequence: ACWDEPSIKAVFDITVSAPKDKVALSNMPVENEKIDGDQRVVKFSPTPVMSTYLVAVVVGDFDYVEDTSEDGVLVRVYTPVGVKEQGKFALYVATKVLPFYKDYFQIAYPLPKIDLVAIADFSAGAMENWGLVTYRQSCL
• ORF Type: internal

Annotations of Ll_transcript_301496

• Blastp: Puromycin-sensitive aminopeptidase from Mus with 69.72% of identity
• Blastx: Puromycin-sensitive aminopeptidase from Mus with 69.72% of identity
• Eggnog: aminopeptidase(COG0308)
• Kegg: Link to kegg annotations (19155)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_015934928.1)
• Pfam: Peptidase family M1 domain (PF01433.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;