Protein coding transcript 258900

• Transcript: Ll_transcript_146592
• CDS coordinates: 1668-2756 (+)
• Peptide sequence: MPSCTRKGSGVPGYDWTSSHVHLYRLHRGITPAMIQDICFSQFSQWIAIVSSKGTCHLFVLSPFGGDTGFKIINSQGEEPSLLPVFPLPWWFMSSSTSYEHPSPPPAPSVLSVVSRIKYSSFGWLNTVHSSTSNVTGKVFVPSGAIAAVFHNSLSHSKQLGNSKVKPLEHLMVYTPSGHVVQHQLLPSVGPEPSECGLRTQSASNLHMQEDEFRVKVEPIQWWDVCRRSEWPEKWDPCGNTVDRQDGIVQEKMCSADGYGLDFWDISRGVGEKVVKHSTGKPQDRFHGYLSNAEVQVNFGRLQIWQKPKIYFYAMNSVRTGFSDGGEFEIEKISANKVEIRQKELLPVFDHFHSIRPSWNDR*
• ORF Type: complete

Annotations of Ll_transcript_146592

• Blastp: Autophagy-related protein 18g from Arabidopsis with 54.52% of identity
• Blastx: Autophagy-related protein 18g from Arabidopsis with 55% of identity
• Eggnog: Breast carcinoma amplified sequence(ENOG410XSW7)
• Kegg: Link to kegg annotations (AT1G03380)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019441802.1)
• Pfam: Breast carcinoma amplified sequence 3 (PF12490.7)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;