Protein coding transcript 258975

• Transcript: Ll_transcript_146716
• CDS coordinates: 897-1469 (+)
• Peptide sequence: MRQAYFPAISNPEGLPLKILDAKGNEWMFQFRFWPNNNSRMYVLEGVTPCIQSMQLQAGDTVTFSRLEPEGRLVMGFRKASSATPSDQDNETNKTGNGFSAQDEVELADASSWSKIDKSGYITKDALGGKSSVRKRKNSILGSKSKRLRIENEDLIELKITWQEAQGLLRPPPSHVASIVVIEGFEFEEYE
• ORF Type: 3prime_partial

Annotations of Ll_transcript_146716

• Blastp: B3 domain-containing transcription repressor VAL2 from Arabidopsis with 60.62% of identity
• Blastx: B3 domain-containing transcription repressor VAL2 from Arabidopsis with 60.62% of identity
• Eggnog: B3 domain-containing protein(ENOG410Z235)
• Kegg: Link to kegg annotations (AT4G32010)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019425639.1)
• Pfam: B3 DNA binding domain (PF02362.20)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;