Protein coding transcript 258984

• Transcript: Ll_transcript_146496
• CDS coordinates: 586-1476 (+)
• Peptide sequence: MSGGEDTTLEFTPTWVVAAICTIIVAISLAAERFLHYCGLFLKRKNQKPLYEALQKVKEELMLLGFISLLLTVTQNGITKICVPSSLTHHMLPCTLDSESQTHSHFQTLFSFPGISRRLLAHADANFCSHKDKVPLLSLEAIHHLHIFIFVLAIVHVTFSVLTVLFGGMQIRQWKHWEDSIAQQNYETDRVLKPKVTHVQQHDFIKGRFSGLGKDSALMGWLLSFFKQFYGSVTKSDYVTLRLGFIMTHCRGNPKFNFHKYMIRALEDDFRQVVGISWYLWVFVVIFLLLNINGML*
• ORF Type: complete

Annotations of Ll_transcript_146496

• Blastp: MLO-like protein 1 from Arabidopsis with 67.65% of identity
• Blastx: MLO-like protein 1 from Arabidopsis with 67.65% of identity
• Eggnog: May be involved in modulation of pathogen defense and leaf cell death (By similarity)(ENOG410ZUVB)
• Kegg: Link to kegg annotations (AT4G02600)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019438245.1)
• Pfam: Mlo family (PF03094.14)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;