Protein coding transcript 2590

• Transcript: Ll_transcript_301508
• CDS coordinates: 3-497 (+)
• Peptide sequence: RSFQYLLMSTHFGSYEANRPGFEKLYRVLSDQNWEASLDLIKHMTKRGGKMNFNYREADNLANVPAKKEVYELHELGSLARALDIQKSLAEEAFHIHHTCSAKDSKHHDAELTHYLEEHFIEKHADTIRNLAGHTSDLKNLLKTSDASLSMYLFDEYLFNKLSG*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_301508

• Blastp: Soma ferritin from Lymnaea with 25.32% of identity
• Blastx: Soma ferritin from Lymnaea with 25.32% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_004492492.1)
• Pfam: Ferritin-like domain (PF00210.23)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;