Transcript | Ll_transcript_146143 |
---|---|
CDS coordinates | 1-399 (+) |
Peptide sequence | VYGQFAYVSQTAWIQTGTIRENVLFGSDMDPQRYQETLHRSSLVKDLELFPHGDLTEIGERGVNLSGGQKQRIQLARALYQNADIYLLDDPFSAVDAHTATNLFKEYIMEGLAEKTVLLVTHQVDFLPAFDTV |
ORF Type | internal |
Blastp | ABC transporter C family member 10 from Arabidopsis with 80.3% of identity |
---|---|
Blastx | ABC transporter C family member 10 from Arabidopsis with 80.3% of identity |
Eggnog | (ABC) transporter(COG1132) |
Kegg | Link to kegg annotations (AT3G59140) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019442089.1) |
Pfam | ABC transporter (PF00005.26) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer