Transcript | Ll_transcript_144949 |
---|---|
CDS coordinates | 126-674 (+) |
Peptide sequence | MAVIWKRINDTGKNWRHVYKALTVLEYLVANGSERVIDEIREHAYQISTLSDFHYIDSSGRDQGHNVRKKSQSLVVLVNDKERIFEVRQKAAANRDKFRNNPSGGMHRPDSYSNSAYGDRYDDRHGSREEDRNDYGYGREREGGYRDDDRSSRDGDRYNRDYEERYGRGGYRDDDSRGRSRSV |
ORF Type | 3prime_partial |
Blastp | Clathrin interactor EPSIN 2 from Arabidopsis with 75.41% of identity |
---|---|
Blastx | Clathrin interactor EPSIN 2 from Arabidopsis with 75.91% of identity |
Eggnog | Clathrin interactor 1(ENOG410XSM0) |
Kegg | Link to kegg annotations (AT2G43160) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019455965.1) |
Pfam | ENTH domain (PF01417.19) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer