Protein coding transcript 259091

• Transcript: Ll_transcript_144951
• CDS coordinates: 3-608 (+)
• Peptide sequence: TLLAGNAQATRNPHEYQMITAVIWKRINDTGKNWRHVYKALTVLEYLVANGSERVIDEIREHAYQISTLSDFHYIDSSGRDQGHNVRKKSQSLVVLVNDKERIFEVRQKAAANRDKFRNNPSGGMHRPDSYSNSAYGDRYDDRHGSREEDRNDYGYGREREGGYRDDDRSSRDGDRYNRDYEERYGRGGYRDDDSRGRSRSV
• ORF Type: internal

Annotations of Ll_transcript_144951

• Blastp: Clathrin interactor EPSIN 2 from Arabidopsis with 74.26% of identity
• Blastx: Clathrin interactor EPSIN 2 from Arabidopsis with 74% of identity
• Eggnog: Clathrin interactor 1(ENOG410XSM0)
• Kegg: Link to kegg annotations (AT2G43160)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019455965.1)
• Pfam: ENTH domain (PF01417.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;