Protein coding transcript 259096

• Transcript: Ll_transcript_144936
• CDS coordinates: 215-1063 (+)
• Peptide sequence: MKKAIGQTVRDLKRGVNKKVLKVPGIEQKVLDATSNEAWGPHGSLLADIAQASRNYHEYQIIMAVIWKRINDTGKNWRHVYKALTVLEYLVGHGSERVIEEIKEHAYQISTLSNFQYVDSSGRDQGNNVRKKSQSLVILVNDKERIIEVRQKAAANRDKFRNNPSDGMYRPGSHSNSAYGDRYDDDRYGSREEDRNGYGYGREREGGYRDDDRSSRDGDRYNRDYEERYGRGGYRDDDSRGRSRSVDYQNESRSRSSDRDRDRSYEDDGHSSRYESIDSVYQ*
• ORF Type: complete

Annotations of Ll_transcript_144936

• Blastp: Clathrin interactor EPSIN 2 from Arabidopsis with 76.47% of identity
• Blastx: Clathrin interactor EPSIN 2 from Arabidopsis with 84.21% of identity
• Eggnog: Clathrin interactor 1(ENOG410XSM0)
• Kegg: Link to kegg annotations (AT2G43160)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019428527.1)
• Pfam: ENTH domain (PF01417.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;