| Transcript | Ll_transcript_144956 |
|---|---|
| CDS coordinates | 267-620 (+) |
| Peptide sequence | MYRPGSYSNSAYGDRYDDDRYGSREEDRNGHGYGREREREGGYKDDDRSSRDGDRYSRDYEEHNGKDGYRYDDYRGRSPNVDYHNESRSRSSDRDHDRSYEDDGHSSRCESIYNAFY* |
| ORF Type | complete |
| Blastp | Clathrin interactor EPSIN 3 from Arabidopsis with 56.48% of identity |
|---|---|
| Blastx | Clathrin interactor EPSIN 2 from Arabidopsis with 77.05% of identity |
| Eggnog | Clathrin interactor 1(ENOG410XSM0) |
| Kegg | Link to kegg annotations (AT3G59290) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019429569.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer