| Transcript | Ll_transcript_144941 |
|---|---|
| CDS coordinates | 86-403 (+) |
| Peptide sequence | MCAHEFLNFENINCLIRFSRFRNNPSGGMHRPDSYSNSAYGDRYDDRHGSREEDRNDYGYGREREGGYRDDDRSSRDGDRYNRDYEERYGRGGYRDDDSRGRSRSV |
| ORF Type | 3prime_partial |
| Blastp | Clathrin interactor EPSIN 3 from Arabidopsis with 58.62% of identity |
|---|---|
| Blastx | - |
| Eggnog | Clathrin interactor 1(ENOG410XSM0) |
| Kegg | Link to kegg annotations (AT3G59290) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_006606594.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer