Protein coding transcript 259115

• Transcript: Ll_transcript_144765
• CDS coordinates: 2-454 (+)
• Peptide sequence: SLIADLQHVKPTHVFNAAGVTGRPNVDWCESHKTETIRTNVAGTLTLADVCREQGILVINYATGCIFEYDAAHPEGSGIGYKEEDKPNFIGSFYSQTKAMVEELLREYDNVCTLRVRMPISSDLNNPRNFITKISRYNKVVNIPNSMTILD
• ORF Type: internal

Annotations of Ll_transcript_144765

• Blastp: Trifunctional UDP-glucose 4,6-dehydratase/UDP-4-keto-6-deoxy-D-glucose 3,5-epimerase/UDP-4-keto-L-rhamnose-reductase RHM3 from Arabidopsis with 88.74% of identity
• Blastx: Trifunctional UDP-glucose 4,6-dehydratase/UDP-4-keto-6-deoxy-D-glucose 3,5-epimerase/UDP-4-keto-L-rhamnose-reductase RHM3 from Arabidopsis with 88.74% of identity
• Eggnog: dTDP-glucose 4-6-dehydratase(COG1088)
• Kegg: Link to kegg annotations (AT3G14790)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019453523.1)
• Pfam: RmlD substrate binding domain (PF04321.16)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;