Protein coding transcript 259128

• Transcript: Ll_transcript_146413
• CDS coordinates: 196-681 (+)
• Peptide sequence: MAKPVSIEVWNPNGKYRVVSTKPMPGTRWINLLVQQHCRVEICTEKKTILSVQDIIALIGDKCDGVIGQLTEDWGEELFSALSRAGGKAFSNMAVGYNNVDVNAANKYGVAVGNTPGVLTETTAELAASLSLAAARRIVEADEFMRAGLYDGWLPHLYNNY*
• ORF Type: complete

Annotations of Ll_transcript_146413

• Blastp: Glycerate dehydrogenase from Cucumis with 93.67% of identity
• Blastx: Glycerate dehydrogenase from Cucumis with 93.67% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (101209132)
• CantataDB: Link to cantataDB annotations (CNT0002414)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019452618.1)
• Pfam: D-isomer specific 2-hydroxyacid dehydrogenase, catalytic domain (PF00389.29)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;