Transcript | Ll_transcript_146421 |
---|---|
CDS coordinates | 125-925 (+) |
Peptide sequence | MAKPVSIEVWNPNGKYRVVSTKPMPGTRWINLLVQQHCRVEICTEKKTILSVQDIIALIGDKCDGVIGQLTEDWGEELFSALSRAGGKAFSNMAVGYNNVDVNAANKYGVAVGNTPGVLTETTAELAASLSLAAARRIVEADEFMRAGLYDGWLPHLFVGNLLKGQTVGVIGAGRIGSAYARMMVEGFKMNLIYFDLYQATRLEKFVTAYAEFLKANGEQPVTWKRASTMDEVLQEADLISLHPILDKTTYHLVNKERLAKMKKEAI |
ORF Type | 3prime_partial |
Blastp | Glycerate dehydrogenase from Cucumis with 91.76% of identity |
---|---|
Blastx | Glycerate dehydrogenase from Cucumis with 91.76% of identity |
Eggnog | - |
Kegg | Link to kegg annotations (101209132) |
CantataDB | Link to cantataDB annotations (CNT0002414) |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019452618.1) |
Pfam | D-isomer specific 2-hydroxyacid dehydrogenase, catalytic domain (PF00389.29) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer