Protein coding transcript 259147

• Transcript: Ll_transcript_146728
• CDS coordinates: 3-512 (-)
• Peptide sequence: NLAPEITQLLHTYSSVFQTPQSLPPNLAPEITQLLHTYSSVFQTPQSLPPPRNQNHAIPLLEGTKPVKIKPYRYPHSQKEQIEKMVHEMLDQGIIQPSTSPFSSPILLVKKKDGSWRFCTDYRALNTVTIKDSFPIPTVDELLDELYGAQFFSKLDLRSGYHQILVQPED
• ORF Type: internal

Annotations of Ll_transcript_146728

• Blastp: Transposon Ty3-I Gag-Pol polyprotein from Saccharomyces with 39.88% of identity
• Blastx: Transposon Ty3-I Gag-Pol polyprotein from Saccharomyces with 39.88% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (YIL082W-A)
• CantataDB: Link to cantataDB annotations (CNT0002914)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_016184914.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;