Protein coding transcript 259215

• Transcript: Ll_transcript_146665
• CDS coordinates: 130-675 (+)
• Peptide sequence: MTMRTPGTPASKIDRTPVSTPGGPRAREEKIMVTVRLRPLNRREQLAKDQVAWNCINDYTIMYKPPPHERAAQPASFSFDKVFGPACLTESVYEEGVKNVALSALMGINSTIFAYGQTSSGKTYTMRGITEKAVNDIYEHIMNTPERNFTIKISGLEIYNENVRDLLNSESGRNLKLLDDPE
• ORF Type: 3prime_partial

Annotations of Ll_transcript_146665

• Blastp: Kinesin-like protein NACK1 from Nicotiana with 81.42% of identity
• Blastx: Kinesin-like protein NACK1 from Nicotiana with 81.42% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (107780313)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019457848.1)
• Pfam: Microtubule binding (PF16796.4)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;