| Transcript | Ll_transcript_147160 |
|---|---|
| CDS coordinates | 598-1074 (+) |
| Peptide sequence | MVSMQYFSEISASTLSSLGSSDTLMSVILGLPLLELISIFTNFTFLLIFLFVVFLRKVHLSVSTARYSKDNRVNNASQISHGFDAEICNFRISTWFKLSVLSCFYVLLVQVLLLGFDGVTLIKGKSKTVDLCLLSVPGVQCLAWLVLSFSALHCKFNVS |
| ORF Type | 3prime_partial |
| Blastp | ABC transporter C family member 5 from Arabidopsis with 42.75% of identity |
|---|---|
| Blastx | - |
| Eggnog | (ABC) transporter(COG1132) |
| Kegg | Link to kegg annotations (AT1G04120) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019455530.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer