| Transcript | Ll_transcript_301492 |
|---|---|
| CDS coordinates | 266-574 (+) |
| Peptide sequence | MSRSSGRIPLILKECHEGPMGGHSGFFRTYKRIASFVFWIGMKTDIKKFVEECDVCQRNKHSTLLPGVYYNLYLFLLKFGVISQWISLEVCLDHKGKILFWW* |
| ORF Type | complete |
| Blastp | Gypsy retrotransposon integrase-like protein 1 from Bos with 37.04% of identity |
|---|---|
| Blastx | Transposon Ty3-I Gag-Pol polyprotein from Saccharomyces with 51.22% of identity |
| Eggnog | Retrotransposon protein(COG2801) |
| Kegg | Link to kegg annotations (504972) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_015964281.2) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer