Protein coding transcript 25930

• Transcript: Ll_transcript_521037
• CDS coordinates: 3-380 (+)
• Peptide sequence: ENYVPSIITRKIFSQVFSFMNVQLFNSLLLRRECCSFSNGEYLKAGLHELELWCLKATDQLAGSSWDELKHIRQAVGFLVYFLISRLKKNVSFFNTQFFKMFCICRFYIKKLKNLWRRSQMNSAR*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_521037

• Blastp: Myosin-11 from Arabidopsis with 61.68% of identity
• Blastx: Myosin-12 from Arabidopsis with 78.75% of identity
• Eggnog: myosin heavy chain(COG5022)
• Kegg: Link to kegg annotations (AT1G54560)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_014501208.1)
• Pfam: DIL domain (PF01843.18)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;