Protein coding transcript 25932

• Transcript: Ll_transcript_521041
• CDS coordinates: 60-602 (+)
• Peptide sequence: MNVQLFNSLLLRRECCSFSNGEYLKAGLHELELWCLKATDQFAGTSWVDLKHIRQAVGFLVLHQKAQKSLEEITNELCPVLSIPQIYRIGTMFWDDKYGAQGLSQEVISRMRVLMTEDSINILSNSFLLEVDSSIPFLMEETFRSMSDICLSDMDVDPPSILRQRPDFQFLLQQIDTDSQ*
• ORF Type: complete

Annotations of Ll_transcript_521041

• Blastp: Myosin-12 from Arabidopsis with 69.07% of identity
• Blastx: Myosin-12 from Arabidopsis with 69.07% of identity
• Eggnog: myosin heavy chain(COG5022)
• Kegg: Link to kegg annotations (AT2G31900)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019445660.1)
• Pfam: DIL domain (PF01843.18)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;