Transcript | Ll_transcript_521043 |
---|---|
CDS coordinates | 60-602 (+) |
Peptide sequence | MNVQLFNSLLLRRECCSFSNGEYLKAGLHELELWCLKATDQLAGSSWDELKHIRQAVGFLVLHQKAQKSLEEIANELCPVLSIPQIYRIGTMFWDDKYGAQGLSQEVISRMRVLMTEDSINILSNSFLLEVDSSIPFLMEETFRSMSDICLSDMDVDPPSILRQRPDFQFLLQQIDTDSQ* |
ORF Type | complete |
Blastp | Myosin-12 from Arabidopsis with 71.13% of identity |
---|---|
Blastx | Myosin-12 from Arabidopsis with 71.13% of identity |
Eggnog | myosin heavy chain(COG5022) |
Kegg | Link to kegg annotations (AT2G31900) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019445660.1) |
Pfam | DIL domain (PF01843.18) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer