Protein coding transcript 259361

• Transcript: Ll_transcript_146360
• CDS coordinates: 885-1223 (+)
• Peptide sequence: MGQLLNPIYILLNVFGLTLVAKLKAEQYIRKSGINYTIIRPGGLKNDPPSGNVVMEPEDTLSRGAISRDQVAEVAVEALALPEASYKVVEIISSPDVPKRPYHDLFGSISQR*
• ORF Type: complete

Annotations of Ll_transcript_146360

• Blastp: Uncharacterized protein At2g34460, chloroplastic from Arabidopsis with 73.39% of identity
• Blastx: Uncharacterized protein At2g34460, chloroplastic from Arabidopsis with 75.27% of identity
• Eggnog: epimerase dehydratase(COG0702)
• Kegg: Link to kegg annotations (AT2G34460)
• CantataDB: Link to cantataDB annotations (CNT0000254)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019433781.1)
• Pfam: NAD(P)H-binding (PF13460.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;