Transcript | Ll_transcript_146360 |
---|---|
CDS coordinates | 885-1223 (+) |
Peptide sequence | MGQLLNPIYILLNVFGLTLVAKLKAEQYIRKSGINYTIIRPGGLKNDPPSGNVVMEPEDTLSRGAISRDQVAEVAVEALALPEASYKVVEIISSPDVPKRPYHDLFGSISQR* |
ORF Type | complete |
Blastp | Uncharacterized protein At2g34460, chloroplastic from Arabidopsis with 73.39% of identity |
---|---|
Blastx | Uncharacterized protein At2g34460, chloroplastic from Arabidopsis with 75.27% of identity |
Eggnog | epimerase dehydratase(COG0702) |
Kegg | Link to kegg annotations (AT2G34460) |
CantataDB | Link to cantataDB annotations (CNT0000254) |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019433781.1) |
Pfam | NAD(P)H-binding (PF13460.5) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer