Protein coding transcript 259364

• Transcript: Ll_transcript_146369
• CDS coordinates: 1101-1433 (+)
• Peptide sequence: MNDYIMQVDNFGTVNLVEACRKRNVNRFILISSILVNGAAMGQLLNPIYILLNVFGLTLVAKLKAEQYIRKSGINYTIIRPGGLKNDPPSGNVVMEPEVLPALLTFHVLI*
• ORF Type: complete

Annotations of Ll_transcript_146369

• Blastp: Uncharacterized protein At2g34460, chloroplastic from Arabidopsis with 79.57% of identity
• Blastx: Uncharacterized protein At2g34460, chloroplastic from Arabidopsis with 79.57% of identity
• Eggnog: epimerase dehydratase(COG0702)
• Kegg: Link to kegg annotations (AT2G34460)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_015957426.1)
• Pfam: 3-beta hydroxysteroid dehydrogenase/isomerase family (PF01073.18)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;