Transcript | Ll_transcript_145495 |
---|---|
CDS coordinates | 412-912 (+) |
Peptide sequence | MIFSRIGRSLSRSSRARNLLQGDGVSYSFVGEGGLGFLRGYIAPASNGFNSNLSDFKSIGANPRLLRLFSSEAPEKKNYDNFSPKEKKEVPKGDDSKQESKDDSNTKTDDHENLKEFFMKQFQNILPLLVLGVFLTFSLGSNEQQQVAVASSILPQPIGVLVCSCR* |
ORF Type | complete |
Blastp | ATP-dependent zinc metalloprotease FTSH 10, mitochondrial from Arabidopsis with 40.72% of identity |
---|---|
Blastx | ATP-dependent zinc metalloprotease FTSH 3, mitochondrial from Arabidopsis with 45.52% of identity |
Eggnog | Acts as a processive, ATP-dependent zinc metallopeptidase for both cytoplasmic and membrane proteins. Plays a role in the quality control of integral membrane proteins (By similarity)(COG0465) |
Kegg | Link to kegg annotations (AT1G07510) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019413392.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer