Protein coding transcript 259394

• Transcript: Ll_transcript_145495
• CDS coordinates: 412-912 (+)
• Peptide sequence: MIFSRIGRSLSRSSRARNLLQGDGVSYSFVGEGGLGFLRGYIAPASNGFNSNLSDFKSIGANPRLLRLFSSEAPEKKNYDNFSPKEKKEVPKGDDSKQESKDDSNTKTDDHENLKEFFMKQFQNILPLLVLGVFLTFSLGSNEQQQVAVASSILPQPIGVLVCSCR*
• ORF Type: complete

Annotations of Ll_transcript_145495

• Blastp: ATP-dependent zinc metalloprotease FTSH 10, mitochondrial from Arabidopsis with 40.72% of identity
• Blastx: ATP-dependent zinc metalloprotease FTSH 3, mitochondrial from Arabidopsis with 45.52% of identity
• Eggnog: Acts as a processive, ATP-dependent zinc metallopeptidase for both cytoplasmic and membrane proteins. Plays a role in the quality control of integral membrane proteins (By similarity)(COG0465)
• Kegg: Link to kegg annotations (AT1G07510)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019413392.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;