Protein coding transcript 259400

• Transcript: Ll_transcript_145501
• CDS coordinates: 2-370 (+)
• Peptide sequence: LGVGGPSGGKSGSGIFNIGKAHVTKVDKNAKNKVFFKDVAGCDEAKQEIMEFVHFLKSPKKYEELGAKIPKGALLVGPPGTGKTLLAKATAGESGVPFFSISGSDFMEMVVGVGPSRVRNLFQ
• ORF Type: internal

Annotations of Ll_transcript_145501

• Blastp: ATP-dependent zinc metalloprotease FTSH 8, mitochondrial from Oryza sativa with 94.5% of identity
• Blastx: ATP-dependent zinc metalloprotease FTSH 8, mitochondrial from Oryza sativa with 94.5% of identity
• Eggnog: Acts as a processive, ATP-dependent zinc metallopeptidase for both cytoplasmic and membrane proteins. Plays a role in the quality control of integral membrane proteins (By similarity)(COG0465)
• Kegg: Link to kegg annotations (4339002)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_020992952.1)
• Pfam: ATPase family associated with various cellular activities (AAA) (PF00004.28)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;