Protein coding transcript 25941

• Transcript: Ll_transcript_521056
• CDS coordinates: 145-618 (+)
• Peptide sequence: MMESSVFVSHVDTLRLLAAAIPSATHRSSWTVSRCLHRSAAPLPTLRLSPLLASNTLTANSAPKSGVYTVGDFMTKKQSLHVVKPTTSVDEALELLVEHRITGFPVIDDNWKLVGVVSDYDLLALDSISGNRQQDNSMFPEVDSNWKVCLTFFLFDS*
• ORF Type: complete

Annotations of Ll_transcript_521056

• Blastp: CBS domain-containing protein CBSX1, chloroplastic from Arabidopsis with 76.84% of identity
• Blastx: CBS domain-containing protein CBSX1, chloroplastic from Arabidopsis with 76.84% of identity
• Eggnog: (CBS) domain(ENOG4111TWY)
• Kegg: Link to kegg annotations (AT4G36910)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019420202.1)
• Pfam: CBS domain (PF00571.27)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;