Transcript | Ll_transcript_147024 |
---|---|
CDS coordinates | 256-858 (+) |
Peptide sequence | MTSSMLSGERRWAGASSRRGGMTVLGKVAVPKPINLPSQRLENHGLDPNVEIVPKGTLSWGGKSSSSSNPWGSSLSPNTDGGTSSPSHLSARPSSGGSGTRPSTAGSDRAFDTTSNAWGSNSRPSSASGALISNQSSLTSLRPHSAETRPGSSQLSRFAEPLTENSGSWSSARTTEKLVGLCYYVCLNLKEPPLFTYEDF* |
ORF Type | complete |
Blastp | Protein MODIFIER OF SNC1 1 from Arabidopsis with 70% of identity |
---|---|
Blastx | Protein MODIFIER OF SNC1 1 from Arabidopsis with 68.35% of identity |
Eggnog | protein MODIFIER OF SNC1(ENOG41124H0) |
Kegg | Link to kegg annotations (AT4G24680) |
CantataDB | Link to cantataDB annotations (CNT0000576) |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019463578.1) |
Pfam | BAT2 N-terminus (PF07001.10) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer