Protein coding transcript 259415

• Transcript: Ll_transcript_147024
• CDS coordinates: 256-858 (+)
• Peptide sequence: MTSSMLSGERRWAGASSRRGGMTVLGKVAVPKPINLPSQRLENHGLDPNVEIVPKGTLSWGGKSSSSSNPWGSSLSPNTDGGTSSPSHLSARPSSGGSGTRPSTAGSDRAFDTTSNAWGSNSRPSSASGALISNQSSLTSLRPHSAETRPGSSQLSRFAEPLTENSGSWSSARTTEKLVGLCYYVCLNLKEPPLFTYEDF*
• ORF Type: complete

Annotations of Ll_transcript_147024

• Blastp: Protein MODIFIER OF SNC1 1 from Arabidopsis with 70% of identity
• Blastx: Protein MODIFIER OF SNC1 1 from Arabidopsis with 68.35% of identity
• Eggnog: protein MODIFIER OF SNC1(ENOG41124H0)
• Kegg: Link to kegg annotations (AT4G24680)
• CantataDB: Link to cantataDB annotations (CNT0000576)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019463578.1)
• Pfam: BAT2 N-terminus (PF07001.10)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;