Protein coding transcript 259417

• Transcript: Ll_transcript_147026
• CDS coordinates: 2-481 (+)
• Peptide sequence: SNSRPSSPTGALISNQTSLTSLRPRSAETRPDSSHLSRFAEPLTENSGACGSVRTTEKLGVAQPKNDGFSLSSGDFPTLGSNKDKSVLNSELQDHSSESHARPGSSSGPWKEIYDTSVVGGTVDTWRRDYQAHYDDGVRPSKEMQQENTQPYLNAGIPPQ
• ORF Type: internal

Annotations of Ll_transcript_147026

• Blastp: Protein MODIFIER OF SNC1 1 from Arabidopsis with 47.34% of identity
• Blastx: Protein MODIFIER OF SNC1 1 from Arabidopsis with 47.34% of identity
• Eggnog: protein MODIFIER OF SNC1(ENOG41124H0)
• Kegg: Link to kegg annotations (AT4G24680)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019463980.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;