Transcript | Ll_transcript_147030 |
---|---|
CDS coordinates | 2-301 (+) |
Peptide sequence | LPSQRLENHGLDPNVEIVPKGTLSWGGRSSSSASNPWGTSLSPNTDGGTSSPSHLSTRPSSGESGTRPSTAGSDRAFDTTSNAWGSNSRPSSSSGALISN |
ORF Type | internal |
Blastp | Protein MODIFIER OF SNC1 1 from Arabidopsis with 70.59% of identity |
---|---|
Blastx | Protein MODIFIER OF SNC1 1 from Arabidopsis with 70.37% of identity |
Eggnog | protein MODIFIER OF SNC1(ENOG41124H0) |
Kegg | Link to kegg annotations (AT4G24680) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019463577.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer