Transcript | Ll_transcript_521058 |
---|---|
CDS coordinates | 145-510 (+) |
Peptide sequence | MMESSVFVSHVDTLRLLAAAIPSATHRSSWTVSRCLHRSAAPLPTLRLSPLLASNTLTANSAPKSGVYTVGDFMTKKQSLHVVKPTTSVDEALELLVEHRITGFPVIDDNWKLVSYSYLFS* |
ORF Type | complete |
Blastp | CBS domain-containing protein CBSX1, chloroplastic from Arabidopsis with 74.6% of identity |
---|---|
Blastx | CBS domain-containing protein CBSX1, chloroplastic from Arabidopsis with 75.81% of identity |
Eggnog | (CBS) domain(ENOG4111TWY) |
Kegg | Link to kegg annotations (AT4G36910) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019420202.1) |
Pfam | CBS domain (PF00571.27) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer