Protein coding transcript 259616

• Transcript: Ll_transcript_146751
• CDS coordinates: 364-936 (+)
• Peptide sequence: MKRYAYINDGESSHDLYCDNRVSNRKYTVLNFLPKNLWEQFSRFMNQYFLLIACLQLWPLITPVNPASTWGPLIFIFAVSATKEAWDDYNRYLSDKKANEKDVWVVRKGVKQHVEAQDILVGNLVWLRENDEVPCDLVLIGTSDSQGVCYIETSAMDGETDLKTRVIPSACMGINVELLHKIKARFYKSS*
• ORF Type: complete

Annotations of Ll_transcript_146751

• Blastp: Phospholipid-transporting ATPase 2 from Arabidopsis with 82.07% of identity
• Blastx: Phospholipid-transporting ATPase 2 from Arabidopsis with 82.07% of identity
• Eggnog: Phospholipid-transporting atpase(ENOG410XPYK)
• Kegg: Link to kegg annotations (AT5G44240)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019426441.1)
• Pfam: Phospholipid-translocating ATPase N-terminal (PF16209.4)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;