| Transcript | Ll_transcript_145129 |
|---|---|
| CDS coordinates | 181-504 (+) |
| Peptide sequence | MLHEGVSEKEACEYMEAMMHTTWKKMNQEACNSSFPENFKDVAINFAKMALCMYQHGDGHTIQDSKIKSRIVSLIFQPIPFSCFMLFLVCDVLVGCYCSNSLPGMVF* |
| ORF Type | complete |
| Blastp | Myrcene synthase, chloroplastic from Quercus with 46.99% of identity |
|---|---|
| Blastx | Myrcene synthase, chloroplastic from Quercus with 46.99% of identity |
| Eggnog | - |
| Kegg | - |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019453842.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer