Protein coding transcript 259657

• Transcript: Ll_transcript_145130
• CDS coordinates: 30-371 (+)
• Peptide sequence: MALLQLASLSISLTNVLPLQRKSTLIATKPFQCMASNNSVPNIQSISRRSTKFEPSIWSYDYIQSLSSEYMDESYKEQSRVLREEVRMMLSKVVNHLDQLALIDVLHRLGVAYH
• ORF Type: 3prime_partial

Annotations of Ll_transcript_145130

• Blastp: Myrcene synthase, chloroplastic from Quercus with 43.55% of identity
• Blastx: Myrcene synthase, chloroplastic from Quercus with 52.87% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019453842.1)
• Pfam: Terpene synthase, N-terminal domain (PF01397.20)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;