Protein coding transcript 259659

• Transcript: Ll_transcript_145147
• CDS coordinates: 2-400 (+)
• Peptide sequence: IQSISRRSTKFEPSIWSYDYIQSLSSEYKASIHSSSLISQTCQDESYKEQSRVLREEVRMMLSKVVNHLDQLELIDVLQRLGVAYHFINEIRNILDCMDTSKGEKNLHATSLEFRLLRQHGYNISTDVFVRFL
• ORF Type: internal

Annotations of Ll_transcript_145147

• Blastp: Myrcene synthase, chloroplastic from Quercus with 52.21% of identity
• Blastx: Myrcene synthase, chloroplastic from Quercus with 52.21% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019453844.1)
• Pfam: Terpene synthase, N-terminal domain (PF01397.20)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;