Protein coding transcript 259695

• Transcript: Ll_transcript_146837
• CDS coordinates: 108-1007 (+)
• Peptide sequence: MKLFNIGIVFTAYRNFSTKGFRKPSFLSYSKYKSKYKTSSTMQTVRRPKIQWTEEQKSVLSSVSQGKSVFITGAAGTGKTKLVTEIVKLLNKLHTPSKVFVTASTGLAAISIKGQTLHSFAGIHYHTNDPKLLYDSIKCCKRAYWRWRKVKALVMDEISMVDARFFDNLERVARELRGVGETWGGIQLVVAGDFFQLPPIPDNDSLDVKYAFEADCWKESFDFMIELTKILRQSDPRLIELLQGIRMGKSDPEDLSILKSYCSKTKSDPSAVQLFPRKQNVKKVNEERLKKLGKVCCCL*
• ORF Type: complete

Annotations of Ll_transcript_146837

• Blastp: ATP-dependent DNA helicase PIF1 from Aspergillus with 43.39% of identity
• Blastx: ATP-dependent DNA helicase PIF1 from Xenopus with 42.4% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (AN6895.2)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019426349.1)
• Pfam: UvrD/REP helicase N-terminal domain (PF00580.20)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;