Transcript | Ll_transcript_146837 |
---|---|
CDS coordinates | 108-1007 (+) |
Peptide sequence | MKLFNIGIVFTAYRNFSTKGFRKPSFLSYSKYKSKYKTSSTMQTVRRPKIQWTEEQKSVLSSVSQGKSVFITGAAGTGKTKLVTEIVKLLNKLHTPSKVFVTASTGLAAISIKGQTLHSFAGIHYHTNDPKLLYDSIKCCKRAYWRWRKVKALVMDEISMVDARFFDNLERVARELRGVGETWGGIQLVVAGDFFQLPPIPDNDSLDVKYAFEADCWKESFDFMIELTKILRQSDPRLIELLQGIRMGKSDPEDLSILKSYCSKTKSDPSAVQLFPRKQNVKKVNEERLKKLGKVCCCL* |
ORF Type | complete |
Blastp | ATP-dependent DNA helicase PIF1 from Aspergillus with 43.39% of identity |
---|---|
Blastx | ATP-dependent DNA helicase PIF1 from Xenopus with 42.4% of identity |
Eggnog | - |
Kegg | Link to kegg annotations (AN6895.2) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019426349.1) |
Pfam | UvrD/REP helicase N-terminal domain (PF00580.20) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer