Protein coding transcript 259765

• Transcript: Ll_transcript_146115
• CDS coordinates: 179-1003 (+)
• Peptide sequence: MDSNNWIPNQSVEPAMDTSDWRAQLMPDSRHRVVNKIMDTLKKHLPVSGPEGLLELRKIAQRFEEKIYTAATSQQDYLRKISLKMLTMETKSQNTMGNNMPSNQVGPSNLPTDQGLVMQHQVHNPGQQQPVSLPNQPQPRQQILSQNIQNNIAPQPNLPPVSSLAQTPSQNMGQNSNVQSTPGQNSVGGTIGQNSNIQNMFPGSQRQMPGRQQVLTQQQQQQSENPQQYLFQQQLFKHKLHMQSQMQQQQQQNLLQPNQLQSSQQSVMQTSSILQ
• ORF Type: 3prime_partial

Annotations of Ll_transcript_146115

• Blastp: Mediator of RNA polymerase II transcription subunit 15a from Arabidopsis with 48.92% of identity
• Blastx: Mediator of RNA polymerase II transcription subunit 15a from Arabidopsis with 48.39% of identity
• Eggnog: NA(ENOG4111KNE)
• Kegg: Link to kegg annotations (AT1G15780)
• CantataDB: Link to cantataDB annotations (CNT0000883)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019421576.1)
• Pfam: KIX domain (PF16987.4)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;