Transcript | Ll_transcript_146116 |
---|---|
CDS coordinates | 849-1607 (+) |
Peptide sequence | MWSTCSFILDILQKRMDTLKKHLPLSGPEGLLELRKIAQRFEEKIYTAATSQQDYLRKISLKMLTMETKSQNTMGNNMPSNQVGPSNKPPDQGLVMQPQVHNPGQQQPVPLPNQSQSRQQILSQNNIAPQPNLPPVSSLTQTPSQNIGQNSNIQSIPGHNSVGSTMSQNSNMQNMFPGSQRQMPGRQQVLSQQQQQQQQSQNQQQYILQQQLFKHKLQLQSQMQQQQQQQNLLQPNQLQSSQQSVMQTSSILQ |
ORF Type | 3prime_partial |
Blastp | Mediator of RNA polymerase II transcription subunit 15a from Arabidopsis with 45.54% of identity |
---|---|
Blastx | Mediator of RNA polymerase II transcription subunit 15a from Arabidopsis with 46.19% of identity |
Eggnog | NA(ENOG4111KNE) |
Kegg | Link to kegg annotations (AT1G15780) |
CantataDB | Link to cantataDB annotations (CNT0000883) |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019456230.1) |
Pfam | KIX domain (PF16987.4) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer