Transcript | Ll_transcript_146923 |
---|---|
CDS coordinates | 3-1157 (+) |
Peptide sequence | KLDAIKKAEDRDLFKQAMKSIGIKTPPSGTGTTLRECMEIANEIGEFPLIVRPAFTLGGTGGGIAYNREEFEEICKAGIAASLTNQVLIEKSLLGWKEYELEVMRDLADNVVIICSIENIDPMGVHTGDSITVAPAQTLTDKEYQRLRDYSVAIIREIGVECGGSNVQFAVNPEDGEVMVIEMNPRVSRSSALASKATGFPIAKMAAKLSVGYTLDQIPNDITKKTPASFEPSIDYVVTKIPRFAFEKFPGSQPILTTQMKSVGEAMAVGRTFQESFQKAIRSLEYGYSGWGCGQVKELDQDWDQLKYNLRVPNPDRIHAVYAAMKKGMEIDEIFELSFIDKWYLQQLKELVDVENFLLSHNLSDLTNVDFYEVKRRGFSDKQIA |
ORF Type | internal |
Blastp | Carbamoyl-phosphate synthase large chain, chloroplastic from Arabidopsis with 86.23% of identity |
---|---|
Blastx | Carbamoyl-phosphate synthase large chain, chloroplastic from Arabidopsis with 86.23% of identity |
Eggnog | carbamoyl-phosphate synthetase ammonia chain(COG0458) |
Kegg | Link to kegg annotations (AT1G29900) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019447909.1) |
Pfam | Carbamoyl-phosphate synthase L chain, ATP binding domain (PF02786.16) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer