Protein coding transcript 259878

• Transcript: Ll_transcript_146923
• CDS coordinates: 3-1157 (+)
• Peptide sequence: KLDAIKKAEDRDLFKQAMKSIGIKTPPSGTGTTLRECMEIANEIGEFPLIVRPAFTLGGTGGGIAYNREEFEEICKAGIAASLTNQVLIEKSLLGWKEYELEVMRDLADNVVIICSIENIDPMGVHTGDSITVAPAQTLTDKEYQRLRDYSVAIIREIGVECGGSNVQFAVNPEDGEVMVIEMNPRVSRSSALASKATGFPIAKMAAKLSVGYTLDQIPNDITKKTPASFEPSIDYVVTKIPRFAFEKFPGSQPILTTQMKSVGEAMAVGRTFQESFQKAIRSLEYGYSGWGCGQVKELDQDWDQLKYNLRVPNPDRIHAVYAAMKKGMEIDEIFELSFIDKWYLQQLKELVDVENFLLSHNLSDLTNVDFYEVKRRGFSDKQIA
• ORF Type: internal

Annotations of Ll_transcript_146923

• Blastp: Carbamoyl-phosphate synthase large chain, chloroplastic from Arabidopsis with 86.23% of identity
• Blastx: Carbamoyl-phosphate synthase large chain, chloroplastic from Arabidopsis with 86.23% of identity
• Eggnog: carbamoyl-phosphate synthetase ammonia chain(COG0458)
• Kegg: Link to kegg annotations (AT1G29900)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019447909.1)
• Pfam: Carbamoyl-phosphate synthase L chain, ATP binding domain (PF02786.16)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;