Transcript | Ll_transcript_146910 |
---|---|
CDS coordinates | 212-1423 (+) |
Peptide sequence | MAAKLSVGYTLDQIPNDITKKTPASFEPSIDYVVTKIPRFAFEKFPGSQSILTTQMKSVGEAMAVGRTFQESFQKAVRSLEYGYAGWGCGHVKELDQDWDQLKYNLRVPNPDRIHAVYAAMKKGMQVDEIFELSYIDKWYLEQLKELVDVEIFLTSHNLSDLTNLDFYEVKRRGFSDKQIAFATKSTEKEVRLRRLSLGVTPAYKRVDTCAAEFEANTPYMYSSYDFECESAPTERKKVLILGGGPNRIGQGIEFDYCCCHASFALQDAGYETIMVNSNPETVSTDYDTSDRLYFEPLTVEDILNIIDLERPDGIIVQFGGQTPLKLSLPLQQYLDEYKPPCASGVGYVRIWGTSPDSIDAAENRERFNVIINELKIEQPKGGIARSETDALAIAADIGYPVVV |
ORF Type | 3prime_partial |
Blastp | Carbamoyl-phosphate synthase large chain, chloroplastic from Arabidopsis with 82.18% of identity |
---|---|
Blastx | Carbamoyl-phosphate synthase large chain, chloroplastic from Arabidopsis with 84.18% of identity |
Eggnog | carbamoyl-phosphate synthetase ammonia chain(COG0458) |
Kegg | Link to kegg annotations (AT1G29900) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019436252.1) |
Pfam | Carbamoyl-phosphate synthetase large chain, oligomerisation domain (PF02787.18) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer