Protein coding transcript 259880

• Transcript: Ll_transcript_146910
• CDS coordinates: 212-1423 (+)
• Peptide sequence: MAAKLSVGYTLDQIPNDITKKTPASFEPSIDYVVTKIPRFAFEKFPGSQSILTTQMKSVGEAMAVGRTFQESFQKAVRSLEYGYAGWGCGHVKELDQDWDQLKYNLRVPNPDRIHAVYAAMKKGMQVDEIFELSYIDKWYLEQLKELVDVEIFLTSHNLSDLTNLDFYEVKRRGFSDKQIAFATKSTEKEVRLRRLSLGVTPAYKRVDTCAAEFEANTPYMYSSYDFECESAPTERKKVLILGGGPNRIGQGIEFDYCCCHASFALQDAGYETIMVNSNPETVSTDYDTSDRLYFEPLTVEDILNIIDLERPDGIIVQFGGQTPLKLSLPLQQYLDEYKPPCASGVGYVRIWGTSPDSIDAAENRERFNVIINELKIEQPKGGIARSETDALAIAADIGYPVVV
• ORF Type: 3prime_partial

Annotations of Ll_transcript_146910

• Blastp: Carbamoyl-phosphate synthase large chain, chloroplastic from Arabidopsis with 82.18% of identity
• Blastx: Carbamoyl-phosphate synthase large chain, chloroplastic from Arabidopsis with 84.18% of identity
• Eggnog: carbamoyl-phosphate synthetase ammonia chain(COG0458)
• Kegg: Link to kegg annotations (AT1G29900)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019436252.1)
• Pfam: Carbamoyl-phosphate synthetase large chain, oligomerisation domain (PF02787.18)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;