Protein coding transcript 259902

• Transcript: Ll_transcript_146554
• CDS coordinates: 49-519 (+)
• Peptide sequence: MASSFVKLDDSPMFQKQLFSLEETTDELKDRCQKLFKGCKKFMTALGEQYNGEISFADSLEAFGGGQDDPVSVSIGGPVISKFITTLRELASFKELLRSQVEHVLIDRLAEFMTVDLQDAKDSRRRFDKAVNSYDQLLMVNYTLVKAVANSSQDNP*
• ORF Type: complete

Annotations of Ll_transcript_146554

• Blastp: ADP-ribosylation factor GTPase-activating protein AGD2 from Arabidopsis with 76.87% of identity
• Blastx: ADP-ribosylation factor GTPase-activating protein AGD2 from Arabidopsis with 76.87% of identity
• Eggnog: domain, ankyrin repeat and PH domain(COG5347)
• Kegg: Link to kegg annotations (AT1G60860)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_003537794.1)
• Pfam: BAR domain of APPL family (PF16746.4)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;