Protein coding transcript 259914

• Transcript: Ll_transcript_146552
• CDS coordinates: 2-319 (+)
• Peptide sequence: ASLNLGILLCIECSGVHRNLGVHISKVRSITLDVKVWEPAVLELFDNLGNAYCNSIWEGLLLLNDERVVESNAPMKPCSTDAFQYKERYIQAKVSRLSSISHLIL*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_146552

• Blastp: ADP-ribosylation factor GTPase-activating protein AGD4 from Arabidopsis with 64.95% of identity
• Blastx: ADP-ribosylation factor GTPase-activating protein AGD4 from Arabidopsis with 64.95% of identity
• Eggnog: domain, ankyrin repeat and PH domain(COG5347)
• Kegg: Link to kegg annotations (AT1G10870)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019413718.1)
• Pfam: Putative GTPase activating protein for Arf (PF01412.17)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;