Protein coding transcript 259915

• Transcript: Ll_transcript_146565
• CDS coordinates: 2-658 (+)
• Peptide sequence: ASLNLGILLCIECSGVHRNLGVHISKVRSITLDVKVWEPAVLELFDNLGNAYCNSIWEGLLLLNDERVVESNAPMKPCSTDAFQYKERYIQAKYVEKSLIFREEDIPGNPSLSIRIWQAVQTINVKEVYRLIVTSNSNLINMTYDDVVHHADGEDLNLGSLNEHQHDPEACLRVKDTNETESCFLGWSLLHLACHSGSPLMVELLLQFGADVNMCDYHG
• ORF Type: internal

Annotations of Ll_transcript_146565

• Blastp: ADP-ribosylation factor GTPase-activating protein AGD2 from Arabidopsis with 54.98% of identity
• Blastx: ADP-ribosylation factor GTPase-activating protein AGD2 from Arabidopsis with 54.98% of identity
• Eggnog: domain, ankyrin repeat and PH domain(COG5347)
• Kegg: Link to kegg annotations (AT1G60860)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019413718.1)
• Pfam: Putative GTPase activating protein for Arf (PF01412.17)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;