Protein coding transcript 259937

• Transcript: Ll_transcript_146213
• CDS coordinates: 184-999 (+)
• Peptide sequence: MTSLSRELVFLILQFLEEEKFKESVHKLEKESGFFFNMKYFEEKVLAGEWDEIEKYLSGFTKVDDNRYSMKIFFEIRKQKYLEALDRQDKKSAVEILVGDLKVFSTFNEELYKEITQLLTLNNFRENEQLSKYGDTKTARGIMLIELKKLIEANPLFRDKLIFPTLKSSRLRTLINQSLNWQHQLCKNPRPNPDIKTLFTDHSCAPPNGPPLAPAPVNLPISAVAKPTAYTSLGVGSHGPFPPAVAPANANALAGWMANVSASSSVQAAVVS
• ORF Type: 3prime_partial

Annotations of Ll_transcript_146213

• Blastp: Topless-related protein 3 from Arabidopsis with 83.46% of identity
• Blastx: Topless-related protein 3 from Arabidopsis with 85.9% of identity
• Eggnog: Positively regulates the activity of the minus-end directed microtubule motor protein dynein. May enhance dynein- mediated microtubule sliding by targeting dynein to the microtubule plus end. Required for(ENOG410XP3K)
• Kegg: Link to kegg annotations (AT5G27030)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019441183.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;